PPIAL4G Rabbit Polyclonal Antibody TA332191 from OriGene Technologies | Biocompare.com

Supplier Images

PPIAL4G Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
PPIAL4G Rabbit Polyclonal Antibody

OriGene Technologies' PPIAL4G Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The PPIAL4G Rabbit Polyclonal Antibody was generated using PPIAL4G as the antigen and it reacts with Human.

Description

Rabbit Polyclonal Anti-PPIAL4G Antibody

Product Specs
ItemPPIAL4G Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA332191
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityHuman
TargetPPIAL4G
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-PPIAL4G Antibody is: synthetic peptide directed towards the C-terminal region of Human PPIAL4G. Synthetic peptide located within the following region: NGSQFFICTAKTEWLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKIT
NCBI Full Gene Namepeptidylprolyl isomerase A like 4G
NCBI Gene AliasesCOAS-2
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!